PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010909880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 403aa    MW: 45511.9 Da    PI: 4.3536
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010909880.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.5e-5071351129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtd el+++yLk+kv+gk++++ e+i+e+++yk+ Pw+Lp k ++++++ ewyfF++rd+ky++g+r+nrat+ gyWk tgkdk+++
  XP_010909880.1   7 LPPGFRFHPTDVELICYYLKRKVTGKSFRF-EAISEIKLYKFAPWELPdKsCLRSKDLEWYFFCPRDRKYPKGSRANRATDIGYWKPTGKDKAII 100
                     79**************************99.89**************96347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + ++++vg +ktLvf+ g+ p+g++t+Wvm eyrle
  XP_010909880.1 101 H-NSHTVGKRKTLVFHVGKPPQGNRTEWVMYEYRLE 135
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-584157IPR003441NAC domain
PROSITE profilePS5100555.2647157IPR003441NAC domain
PfamPF023651.4E-268134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MTAKTLLPPG FRFHPTDVEL ICYYLKRKVT GKSFRFEAIS EIKLYKFAPW ELPDKSCLRS  60
KDLEWYFFCP RDRKYPKGSR ANRATDIGYW KPTGKDKAII HNSHTVGKRK TLVFHVGKPP  120
QGNRTEWVMY EYRLEDKELV DAGSSQDMYV LCKIFQKSGP GPKIGEQYGA PFNEDDWEDD  180
TIIENAFSFP CAPTSIPLDD HPVLLEPICQ QSVASGHCEV SSTPDLPDAD GMLLEQLAEL  240
LNDSPLHSEN AHNKISSSAV LDENINEVSG VETGIYDELE DLSAEAGIND NLNYSGTMDR  300
EYELQPMLSE LGSEQYVELN DLRFLWESDS SDLVMRDDLF DQYPLVENPG SFHLSNTYDH  360
PFSIGSVTTA VTNDPLSVGA DMVGDRSTLF LELEDLRSTP FCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-51716317171NAC domain-containing protein 19
4dul_A8e-51716317171NAC domain-containing protein 19
1ut7_B8e-51716317171NO APICAL MERISTEM PROTEIN
1ut7_A8e-51716317171NO APICAL MERISTEM PROTEIN
1ut4_B8e-51716317171NO APICAL MERISTEM PROTEIN
1ut4_A8e-51716317171NO APICAL MERISTEM PROTEIN
3swp_D8e-51716320174NAC domain-containing protein 19
3swp_C8e-51716320174NAC domain-containing protein 19
3swp_B8e-51716320174NAC domain-containing protein 19
3swp_A8e-51716320174NAC domain-containing protein 19
3swm_D8e-51716320174NAC domain-containing protein 19
3swm_C8e-51716320174NAC domain-containing protein 19
3swm_B8e-51716320174NAC domain-containing protein 19
3swm_A8e-51716320174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909881.10.0PREDICTED: NAC domain-containing protein 2-like
RefseqXP_010909880.10.0PREDICTED: NAC domain-containing protein 2-like
RefseqXP_010909878.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ9FY825e-78NAC82_ARATH; NAC domain-containing protein 82
TrEMBLM0RQN01e-155M0RQN0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P09000_0011e-155(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.16e-81NAC domain containing protein 103